DPCstruct | MC16719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 64.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6V1F6 | 1-169 | MSWRRVLKSLQAVLAHGFLFTFTLLLALKLDRTLHHSWWVIFLPLWLFHVVVARGRFSLPAPSMPHDRHWAPFHAVMAIPLLVAFEL… |
| A0A2P2L969 | 10-152 | SWRRVAKSLQALVAHGLLFSFTLLLVLKLDHALSYSWWTIFGTLWLFHMVVARGRFSLPAPSAPHNRHWAPSHSILATPLLIAFELL… |
| A0A5D3DY81 | 1-182 | None |
| A0A453KT94 | 3-164 | None |
| A0A453KT83 | 56-225 | None |
| Q9C9B6 | 4-209 | None |
| A0A0D9XDL9 | 28-197 | None |
| A0A0D9XDM0 | 29-197 | None |
| A0A835HBA1 | 4-130 | None |
| A0A287RGC9 | 21-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.