DPCstruct | MC16718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437N0Z9 | 2-83 | VEMAGVFELGAKKYGPFNWRETKVEAMTYVNATLRHLLSWLDGEDTDPESSKSHLGHAMASLGIVIDAMHTNQLIDNRPTQG |
| N6VDQ0 | 152-255 | TERDVKAACKDDAHKSRVDLIPPSALFAIGHVLAVGARKYGANNWRNGMDWSRLHGAALRHLLAWFNGEDKDPESGLSHLAHAACCL… |
| A0A357CMZ5 | 1-90 | None |
| A0A0F9NDH2 | 3-124 | None |
| A0A2A4ZM05 | 3-100 | None |
| A0A0F9K7H7 | 120-240 | None |
| A0A0F9CFP8 | 2-128 | None |
| A0A0F9BVH6 | 3-107 | None |
| A0A5C7QFX2 | 29-145 | None |
| A0A5C7PR97 | 334-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.