DPCstruct | MC16717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366LZ07 | 1-176 | MLVPDLGEDLARAAAMLERAMLSLRAAERRGTELPGPLAAGAALGALRRLWRAVAPTQGGSAAGRLYGAGGRVEHLPLRLVDIDPVD… |
| A0A5B0HDE7 | 13-222 | RRVLVPDLGDELTEVLRQVEELLLTLAAWEEEPDCPGPFVLPAPLAGRGALDALRRIQDILVPTQTPSEMLDRGAQVGPRLVGPDGR… |
| A0A1C5CHS5 | 1-186 | None |
| A0A6J4GZZ5 | 23-245 | None |
| A0A7Y8TKD9 | 6-177 | None |
| A0A3D5ANR1 | 2-169 | None |
| A0A7W7RBY9 | 1-248 | None |
| A0A222W1C4 | 241-457 | None |
| A0A1H3MCV3 | 212-429 | None |
| A0A4V2PIF4 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.