DPCstruct | MC16715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A208ZX81 | 2-102 | GAPIPVQIADKLRGRKFSSFGEFRRALWLEISKDPTLSEQFKSGNLGNIKNGKAPSPRESEQVGGRVKHELHHVKPISKGGAVYDID… |
| A0A3M4C2Q0 | 107-215 | QPAAAGWWENIAHEHGVAIPTQLGDVLRERGFKSQDTFEKAFWKAIARDVILGNAFDEINQTRMRRGYAPYAPKAAWAAERREFELR… |
| A0A2U1IUF2 | 417-534 | None |
| A0A7Z2QR66 | 147-264 | None |
| A0A750KZJ7 | 768-893 | None |
| A0A1Y6ISU1 | 300-428 | None |
| A0A357B9X6 | 1077-1202 | None |
| A0A2K4VMT9 | 532-649 | None |
| A0A1H3M140 | 300-423 | None |
| A0A2N0DRJ2 | 34-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.