DPCstruct | MC16714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814CTT7 | 240-435 | NRLSPTTRKHCFFLFADEHHKNTMAGNGTGALENIVRSWLDRHHNQLDLHLTHPPITFKKSSDYPFMFTADTDNVRITIGFKTESLN… |
| A0A813BL49 | 1-181 | MGASHSEPEPAGAETEDDSSQEVMAQVESWIQEHPVFETVITGAKLKCSACPVAAHAYQSALTDDSFGISFKQPLTGTERLEEIQAK… |
| A0A821LUT3 | 264-394 | None |
| A0A3B9HJI6 | 1-190 | None |
| A0A250XNM3 | 1-142 | None |
| A0A4Q7XGW5 | 3-172 | None |
| A0A1X7UKS9 | 1-185 | None |
| A0A7D9J0J2 | 23-209 | None |
| A0A2G3K9Q4 | 4-150 | None |
| A0A844ZNF0 | 53-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.