DPCstruct | MC16713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813DH37 | 94-237 | QKAFEDCFGLAWKLALEKDLVCNASEAMERLGFSSQELDRRWTPLQIGTDKVKFGGGFYCGYIEGLYVINGFYCSMRSQYTETGTSV… |
| A0A1Z5K526 | 99-246 | ADKFQNAFGESWETVLAENRACNAMEACKRFGCDAQQLDEAWGKAEKVEKFGGGFYCGIVSMNGQKLYVFNAFFMSMRSKFVGAGTS… |
| A4UHC7 | 74-222 | None |
| A0A1Q9CVR0 | 141-294 | None |
| A0A7S4ICW1 | 1-137 | None |
| A0A812TUL1 | 373-526 | None |
| A0A7S2GNV4 | 26-179 | None |
| A0A813GDC6 | 742-882 | None |
| A0A7S3NH22 | 2-139 | None |
| A0A812Q3K0 | 210-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.