DPCstruct | MC1671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8ZEB7 | 1-66 | MNKKRSAAVAKRRADMPKTYRGIYDRCTKGRSRKAAMQSFCLECMGWQRKEVALCTSLECPLYGFR |
| A0A532UQZ3 | 1-93 | MMTLTGVKSKRKRTGMTAKRQAAIEERLAQIPDLYKSIYWRAVEGKSMRASVNAQCLECVGWVRAEVHLCTDLGCPLYSKRPYQRIK… |
| A0A0F8YEC1 | 4-86 | None |
| X0YCN3 | 32-105 | None |
| A0A660USA4 | 3-102 | None |
| A0A0F9MKA4 | 3-71 | None |
| A0A1Q2HQI5 | 13-116 | None |
| A0A1V5NBS8 | 1-82 | None |
| A0A0F9R932 | 7-106 | None |
| A0A0S7Y1E2 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.