DPCstruct | MC16709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 184 ± 25 aa |
| Standard deviation of domain lengths | 25.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139B0B7 | 1-118 | MKWNPTLSKWEGNEEDLRDFDVPSPTRPALISNLGIPTSGTVSVGAMTFDPVKMRWVGNEREMDDAFGEFGDDDAASVMSIPIASRR… |
| A0A3N4M918 | 4-188 | LQFRVTNIFFSRCITAVKGMTYNPRLFRWEGNEHTLEDFDRHQAITPPRPALITNINANTSGISKGIQIVGDMLFDPQRMCWLKVAG… |
| Q75CK9 | 272-472 | None |
| A0A1E4RF92 | 85-284 | None |
| A0A1G4JEE9 | 308-534 | None |
| A0A0G4LXC9 | 8-200 | None |
| A0A1E3NK59 | 420-596 | None |
| A0A3N4L1P4 | 1-176 | None |
| L0PGT6 | 8-176 | None |
| A0A2T0FCK6 | 354-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.