DPCstruct | MC16708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 222 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178DWU9 | 1-222 | MVSRRIDQQTRPPQLHCPDCNEDARGYRGQHELERHIAREHSRTRKGFVCFDASADQQFLAKCKHCSGQKVYWAYYNAAAHLRRAHF… |
| A0A6A6V2L1 | 52-231 | LPRRKDRPDHPKPPTWPSAPTRSPPRSACPHCSITLRGEHELKRHLSRAHTSFRKAYICINGSSDPDFFANCKFCMAKKVYAVDYNA… |
| A0A178B1W7 | 109-367 | None |
| G0RYW5 | 278-535 | None |
| A0A2T4C0V0 | 58-239 | None |
| T0KPW0 | 171-367 | None |
| A0A2J6R980 | 677-929 | None |
| A0A1Y1Z3I3 | 85-318 | None |
| A0A0D2AF01 | 401-623 | None |
| A0A364LBA6 | 237-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.