DPCstruct | MC16705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.34 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0125- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844VU31 | 2-105 | NYQNDDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHQILKGDDDRLLVVIGPCSIHDPAAAKEYASRLLTLREALKGELE… |
| A0A090RML7 | 3-105 | KDSLNNVHIENESVLITPQQLRDKLPVSDTALEFVRESRQTIADIIHKRDHRLLVVCGPCSIHDIEAAKEYAVKLKALSEELQDQLY… |
| A0A507F3E7 | 326-431 | None |
| A0A378A5H0 | 1-77 | None |
| A0A7J6PPI9 | 4-108 | None |
| A0A7H4MQK0 | 3-105 | None |
| A0A367L4T4 | 11-117 | None |
| F0WTK3 | 15-126 | None |
| A0A2S7YLP0 | 197-310 | None |
| A0A496Q2T1 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.