DPCstruct | MC1670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 370 ± 36 aa |
| Standard deviation of domain lengths | 36.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532UE29 | 14-408 | TKELLSKVATGENLTKERDQLLKKVWPAVLRDALKILKKNDPREWPKGKDSTIGTFFDEASLGVSDLQEVLSGFSDFEGVMYGASPE… |
| A0A352FTN2 | 1-442 | MDINATLLTHLATGAGAASILRAVRPNVVALAQSFFEARTDISRLQTAQNVAEEILLKNDLRDLIEIRDIVAKQELHRQIRYGKQQD… |
| A0A1E3X4V0 | 11-314 | None |
| A0A7J9T5I7 | 2-335 | None |
| A0A846NSP2 | 85-486 | None |
| A0A843H070 | 29-426 | None |
| G2FVP3 | 258-651 | None |
| A0A662QGK7 | 80-527 | None |
| A0A1G0THE3 | 342-688 | None |
| A0A662IJS0 | 3-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.