DPCstruct | MC16695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 96.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 52.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8MV39 | 19-82 | NWLKKCGFVDIRIADVSVTTTEEQRRTEWMVTESLADFLDSHDPGKTVEGYPAPKRAVLIARKP |
| A0A090QSW2 | 2-56 | VDVRIVDECVTTTDEQRSTDWMTNNSLPEYLDPADPSKTIEGYPAPKRAVLIARN |
| A0A486XAN9 | 60-120 | None |
| A0A3B0YWB5 | 2-64 | None |
| F3KDN3 | 269-319 | None |
| A0A7Y3H7U3 | 45-109 | None |
| A0A2G6NBP2 | 1-47 | None |
| A0A1B8J9L7 | 445-506 | None |
| A0A2D3VXF4 | 8-70 | None |
| H5VDL3 | 47-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.