DPCstruct | MC16694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655MSF0 | 94-167 | DDQEISSTIRSIEQVFKLVEQGEGFYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMY |
| A0A090QSK9 | 3-78 | AIPTTLEPVTSGNGFYRDGSFLQHVNIPYMGGYGLVLLNGIARVLDAAQHTGLDVSDPRYALVDTYLLRSLLPFMY |
| A0A0U0KAG0 | 2-74 | None |
| F4LPB7 | 186-282 | None |
| J1DL83 | 208-291 | None |
| W4UBC5 | 16-101 | None |
| A0A2S6DA25 | 1-93 | None |
| A0A7G8UUP2 | 34-114 | None |
| A0A090QWC4 | 137-222 | None |
| A0A1H6E9W3 | 242-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.