DPCstruct | MC16690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838DZI4 | 168-312 | TVALDRDAPALAGYQAVLANLTEGMAANWQGTVDDVDPDFLHDLRVAVRRIRSVLAQGKRVLPAEPRRRFGEGFRWLGHITGRARDL… |
| A0A090QI00 | 4-158 | LKHAATANSDPKAAISSKTLAQTTLHHHYHRFTKRSEGITATSPDHKLHQLRIEGKKFRYALEYFTPLYPKAQAKQQLLLLKQVQTS… |
| A0A7V5V741 | 2-124 | None |
| A0A7J3JB71 | 1-158 | None |
| A0A4Y8PQC2 | 1-136 | None |
| A0A522QBR0 | 2-131 | None |
| A0A7X9DFH7 | 1-155 | None |
| A0A6N6WGH6 | 1-169 | None |
| A0A5J4KGT3 | 122-267 | None |
| A0A1Q9UUT2 | 56-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.