DPCstruct | MC1669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 56.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A120J220 | 5-63 | GWSRDEMAARVAAEFEDGQYVNLGIGMPTLIPNHIPDGVHVVLHSENGILGVGPTRGGR |
| A0A791F3V7 | 1-59 | MDAKQRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTTAH |
| A0A2H9TNJ5 | 157-220 | None |
| A0A245ZNL1 | 159-213 | None |
| A0A2V9H248 | 13-66 | None |
| A0A3Q8V660 | 3-58 | None |
| A0A0P1ARN3 | 545-598 | None |
| A0A0N0V5T3 | 286-346 | None |
| A0A4Q7R5M5 | 3-59 | None |
| A0A5N6L9W2 | 265-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.