DPCstruct | MC16689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 197 ± 31 aa |
| Standard deviation of domain lengths | 31.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2Z7D7 | 78-290 | THINIDYDGKSIKFLDVIKNSAKLIRRGHKDNITSFDEGFKFYLLKDRIDFVLAVKILGANTINKIRYSLKGVVLSSVSDIAIDDIV… |
| V5W5M3 | 2-249 | VPSIRISTTASLSIPSNTEENYLGKALFVVGENNIVTYIPVNIQGVLINLLDKINEKNHLIRNKHKDIRTSFDMSCKFYHIKSRIDY… |
| A0A891ZRJ1 | 17-135 | None |
| P22374 | 415-603 | None |
| A0A895KUE4 | 178-362 | None |
| A0A895KV26 | 116-312 | None |
| A0A534C3Z7 | 12-233 | None |
| A0A7T3PCP6 | 176-392 | None |
| A0A481ZKZ8 | 1-246 | None |
| A0A6C0W3U7 | 114-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.