DPCstruct | MC16684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 444 |
|---|---|
| Mean domain length (aa) | 144 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3QZR0 | 2-99 | HADRCQVCGIQLATRFGTYSEGAHIRGLGRPHDGPDEPANLLVLCPNHHVQFDALAIYVDTADVVRYTADDGRIGDLRRIPEHPISW… |
| A0A1B0QY52 | 15-151 | QPNIPDETTVPGKRKGSKTTVETRPDQASFAEAVRNNCYDQCVITGSRLRQRTEAAHLMEHRNGGVDHYTNGLLLRHDIHDLFDANM… |
| A0A6B3AS63 | 60-193 | None |
| A0A1H9UCZ9 | 16-136 | None |
| A0A6P1DA22 | 2-105 | None |
| A0A194V116 | 1-151 | None |
| A0A7S2U931 | 120-303 | None |
| F4PIS2 | 540-686 | None |
| A0A066VCC8 | 42-187 | None |
| A0A318YXN3 | 76-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.