DPCstruct | MC16682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 240 ± 49 aa |
| Standard deviation of domain lengths | 48.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8ZQR5 | 5-336 | NITILIIALCVSTAFSQGNCVKGISTNPANPINNEFQGLINPWLNTSFEVAPIDENGFGFEPLNMNNTAGWSVPNYVSGNLLMVSPY… |
| A0A1I0FCR4 | 24-229 | DREKAEPVISVRALTNTTGQAAIVVQPVFPTPPTKNDPAADFDWETDLTLPAPAEQPAVPVPWAPTAKRAFPIQWASDYLRADGWEL… |
| A0A3E4MR45 | 5-229 | None |
| A0A418QJ70 | 1-182 | None |
| A0A2J6WBI6 | 24-303 | None |
| R6BBT8 | 1-213 | None |
| A0A366KZF6 | 1-177 | None |
| A0A3B9ANP3 | 1-213 | None |
| A0A7K3WYB3 | 26-335 | None |
| A0A081PM72 | 4-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.