DPCstruct | MC16681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A352CDS3 | 81-184 | SPKRVTLLLARDDVSVARPLLEESTALNDSDLIHITQTASSAHRRIIAARKNLGEAVVDMLAIHGDVQTLSVLLLNTTASISITTMD… |
| A0A371B7E9 | 80-182 | PRSVVAQLSGSDDIAISGPALEKSEGISDEALVSIANNKSQKHLKAIAGRSTLSEVVTDVLVDRGDSEVSRRVGANLGARLSEMGFV… |
| J6UB19 | 152-255 | None |
| A0A2N3C0V8 | 414-519 | None |
| A0A0P7YBW5 | 78-184 | None |
| A0A4R7BQW2 | 88-177 | None |
| A0A5A7NK54 | 77-178 | None |
| A0A2P7P2U7 | 1-94 | None |
| A0A182D469 | 298-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.