DPCstruct | MC16679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 129 ± 10 aa |
| Standard deviation of domain lengths | 9.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E7V8K8 | 43-151 | IYSLFAKGELRLRCEVSCAWAWGGNKGKLTGLYQNKLWKDLALLTAEVNLDRNISYFYLGRSAEGLGLYPAADVYYRLSNAGRFACT… |
| A0A437RK08 | 19-148 | TACATERAGTDDPIEQHQIVTELDAGRLRLTCDLACAGTWRAARKALRGLHQHGVWQELVVEVVRIGYASDLGYFYLGRAAEARGRP… |
| A0A1V5QJA7 | 6-145 | None |
| A0A1V4XWR4 | 19-155 | None |
| A0A4R3UIH9 | 10-155 | None |
| A0A2U1WVU7 | 2-130 | None |
| A0A5S4ELB2 | 1-130 | None |
| A0A2E8JS79 | 354-477 | None |
| A0A1H8AND7 | 2-120 | None |
| A0A562PNC4 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.