DPCstruct | MC16678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7IVN6 | 23-131 | ASSQNAGGSAPASQKELAAAWPLSNESHVANNMKCGACHDEEDPTQGAAAVTADTCLSCHGSYERVAERTAAIGEDVNPHDNFHYDM… |
| A0A365U7V5 | 159-247 | LDHTHYLAGVSCAACHGEADPPKEPDTAVCETCHGSLETLARLTADVAPVNPHDSPHGTPYAECSLCHLQHRRSEDFCATCHDFGFD… |
| A0A227KHW0 | 10-97 | None |
| A0A837PCJ9 | 1-107 | None |
| A0A1H8ZF98 | 133-221 | None |
| A0A336P3Q0 | 544-661 | None |
| B8FHN5 | 6-101 | None |
| A0A1Y0HM50 | 20-124 | None |
| E1YCA8 | 19-124 | None |
| A0A2N6DCS0 | 127-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.