DPCstruct | MC16674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 137 ± 21 aa |
| Standard deviation of domain lengths | 20.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1XS82 | 6-143 | VDDLFEKAGYLASKDEIEVYKSLNTVESKRRYLFDFWRKKEKGRPGFRQEYYARVNYCDQQFAASGVPGWKTDRGRVYILYGPPDNI… |
| A0A2V7P0W4 | 1-138 | MQAEERGVYPALSLAGKRDFLRRFWAPRDPTPGTSKNEAEETFNARIAVVNRKFRESGTSDVPGWRTDRGRIYLEYGPPDITLGRRG… |
| A0A7W0YTR6 | 176-315 | None |
| A0A660SBT9 | 43-174 | None |
| A0A7Y5KHS7 | 80-214 | None |
| A0A7Y5KGL4 | 7-110 | None |
| A0A836SSH6 | 11-152 | None |
| A0A7C7V9E8 | 14-143 | None |
| A0A0S8HAK7 | 313-441 | None |
| A0A7V1ZFK4 | 95-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.