DPCstruct | MC16672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7LKA8 | 37-137 | LRRGAWYRILKLTSMEATLNVKGKPFAVPRGQLELAAEPILRWTVVAAPRGAPRFPTSWGQQYAVCPSCRERAPLLDQPTAMRCQRC… |
| A0A2V7NC17 | 141-230 | LRRGAWYPVLSAGPDEVVLDVRHHAVIVPWSVLEISDTRPSRWSLVLRDGTLGGPYLVCPDCAARMSLQVGLDRVPCDRCHGVYEVE… |
| A0A1Q7JF90 | 17-113 | None |
| A0A0S7ZG80 | 69-170 | None |
| A0A534AQ58 | 18-118 | None |
| A0A1Q7AAN0 | 1-84 | None |
| A0A2V7GZN2 | 18-117 | None |
| A0A2V7J078 | 3-94 | None |
| A0A2V7R3C3 | 2-79 | None |
| A0A2V7MB96 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.