DPCstruct | MC1667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 183 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03729 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8CIQ5 | 13-193 | SLDSAALSRTAVNSIRAALGIGGAVALIVGLLITFQPEAAATTIAVLLGVYFVIAGVVYVVVGITARGLSGAARALDACLGVLFLVG… |
| A0A109SWM2 | 137-320 | PSPVVSPLPRLLPHLWKSTLASGILSLILGVLVLAWPGISILVAAMAFGVYLLITGVAQVAFAFSLHVSAGGRILLFISGAASLILA… |
| A0A2V4TML7 | 1-200 | None |
| A0A344UU12 | 2-199 | None |
| A0A847SIJ4 | 109-278 | None |
| A0A831RMF5 | 72-255 | None |
| A0A1Q7WGI2 | 238-418 | None |
| A0A358SV29 | 100-290 | None |
| A0A192A564 | 2-179 | None |
| A0A847CF25 | 5-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.