DPCstruct | MC16669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 53.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2TX45 | 85-193 | KNRDAWSENSYHSGILRSPENHRWVTAMDIAIGQAKCLDDPAMRDVLIAIADWKIDKKVFEYIEKLPDWVRLSHKAQALVKASNDYY… |
| A0A5E7RK98 | 334-439 | TDNSYHSAVLRSPENHRWVTAMDVAIGQARCLDDPVMREVLVAIADWRIDKERFKEVSSFLGWSRLSAKARALVQASYQYYDKGKFP… |
| Q2T953 | 126-236 | None |
| A0A2S4M7G2 | 148-267 | None |
| A0A3M5W1M9 | 71-170 | None |
| A0A3M5ES56 | 163-270 | None |
| A0A3M5Q4A5 | 221-332 | None |
| A0A3M5WZX8 | 232-343 | None |
| G7THW0 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.