DPCstruct | MC16667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 139 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497MC91 | 195-361 | TYKIKKVLPCIADPSKIRLVAQLDANIEDLLPILYLHLKRSNYIEALDALTFTTDRDEMVTIYGDGRVYAGKVEDPERLLSELLKLL… |
| A0A7C1FAY3 | 28-192 | IRITQVMDCLADPERIRAVAVPSTDIGPALPYLASLLPQAGYNHEAGILTLVHHGRLLTVYRQLVTLAKALDEQDAEDVLEWLRQKI… |
| A0A170NJK3 | 2-108 | None |
| A0A7J2THF1 | 2-126 | None |
| A0A2M7BKC6 | 1-113 | None |
| A0A0S7YIY0 | 114-260 | None |
| A0A6I1ZTQ0 | 58-223 | None |
| A0A1V4QLT1 | 17-146 | None |
| A0A1G3QZ42 | 9-173 | None |
| A0A7C0ZCR9 | 2-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.