DPCstruct | MC16666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 121 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497MBK4 | 3-126 | AFLHHYYVVSSVRSDKSRIIDPCGRILAQTDWWVNVIYRDINLDYVVAHYDFNYSIPDKILKAYPGRVKVKSYTDDSLFLVEPIDDS… |
| A0A7C4H822 | 41-159 | WAFNFGIYMVSAYTGEGSMIVNPLGKVVASSSIHEPIISKTINLDYKILHIDYNRDKWEGIKSKYGPHVEIDVASSEGVFLLISHLQ… |
| A0A1V5LL77 | 102-234 | None |
| A0A7C3BUT6 | 18-133 | None |
| A0A5C6D6E2 | 17-137 | None |
| A0A6B0GJB7 | 219-359 | None |
| A0A7C4C2E2 | 2-99 | None |
| A0A7C0YII1 | 87-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.