DPCstruct | MC16663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844RL15 | 103-197 | TATEGTNPDGLVFPEALSLAQVEGIQQLLARVDVADRQMVLDELAGRMSGHTPIKSPVGWVSGLVQRMAEGPVVFAHAEQVAIDRRM… |
| A0A2N2UE68 | 6-147 | RGCASVEPDSTSGLILPERLDAASRAGVLSMVARAPVELQQPLLDELAGNLSIPNKTIHNPIGWLHSLIQRQRQGTVELALAPQIAQ… |
| A0A4P6WWL8 | 421-546 | None |
| A0A482Z0B4 | 35-163 | None |
| C6XEL3 | 207-323 | None |
| A0A679I957 | 30-174 | None |
| J2MDV6 | 28-140 | None |
| A0A383X5C2 | 156-277 | None |
| A0A1L5QY95 | 1-121 | None |
| A0A2G2LKP7 | 84-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.