DPCstruct | MC16661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 232 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.65 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0484- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6LCK4 | 780-1016 | ARLARAEPPLRRETVEYMLDVDYHMWSLRRSKANFGRIMKLLTGVAAVCQWFNDICKWRNPVTTCLVHVLFLILVCYPQLILPTIFL… |
| A0A5D2XLU8 | 21-261 | HTLSSRLRRAEPPLQSEVVEYMLDVGSNVWSLRRGRANLERLLAAFNLLVEAWKWFDQIRKWKNPISTMAVHFLYSMLILFPDMILP… |
| A0A0A8Y3H9 | 1-211 | None |
| A0A2N9HMB9 | 737-968 | None |
| A0A446KXV1 | 4-242 | None |
| A0A2P5XBX0 | 641-877 | None |
| C1E1D6 | 26-227 | None |
| A0A1R3IE56 | 936-1172 | None |
| A0A7J9FSB8 | 335-570 | None |
| A0A804KUV7 | 226-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.