DPCstruct | MC16660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453SPI7 | 1-109 | MGVISRKVLPVCGALCYFCPGLRARSRQPVKRYKKILAEIFPRSQDEEPNERRIGKLCEYAAKNPLRVPKITVYLEQRIYKELRAEQ… |
| A0A5D2XET8 | 1-109 | MNVIHRQVMPACGSLCFFCPSLRTRSRQPVKRYKVLIADIFPRKKEDGPNDRKIGKLCEYASKNPLRIPKITESLEQRCYKELRNEN… |
| A0A453I8K6 | 101-209 | None |
| A0A445IMJ6 | 15-103 | None |
| A0A6N2NIZ2 | 5-113 | None |
| A0A5D2HWY4 | 1-109 | None |
| A0A0D9YZ74 | 17-106 | None |
| A0A1S4DIN5 | 1-108 | None |
| A0A445KDI8 | 15-103 | None |
| A0A078IFI1 | 275-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.