DPCstruct | MC1666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811A2L2 | 12-113 | ATTKEVWNRLTCAGFLMMLAVIVPIISHYGFWKLPDETIPAWVMRSGALVTMLALLAEHVLSEGVPRLTNPLISRFQSAFSIMRKIA… |
| U1KRN0 | 1-123 | MSEEKLSISKLDKTIFKSIIMCTALTTISIISIILGWFGVFKPNTEGLDVWFQRSGSITVVFALLCEFKLFPVNNSLYISRIHFNDF… |
| B1FDU9 | 47-165 | None |
| A0A0X3TCC6 | 27-147 | None |
| A0A136QN68 | 8-125 | None |
| A0A099K845 | 3-112 | None |
| A0A1N7PPZ3 | 4-106 | None |
| A0A7W2NRC2 | 10-136 | None |
| C3KA06 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.