DPCstruct | MC16658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 177 ± 32 aa |
| Standard deviation of domain lengths | 31.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662BH13 | 5-149 | EDKLLEKAKLQLMMKPDTLFYSTILFSLVFSWTKELPTAGTDGTHLMINPEYFKNLTEPERIGLLAHEVLHVALSHMTRRMTRNPLL… |
| A0A0U2JET9 | 17-149 | DAYSRALQAARVRAAYQRSYFAPALFSLVPVPTDVIDSMAVDSHWRLYYNDAWVATHTVEENATLLIHEVGHLLRDHEGRKKTAGIR… |
| A0A0D0SCT2 | 2-207 | None |
| A0A4R2E6I4 | 2-129 | None |
| A0A497NYA2 | 9-216 | None |
| A0A136PUN6 | 6-153 | None |
| A0A2G6MQU1 | 5-213 | None |
| A0A7C5HDZ0 | 3-113 | None |
| A0A414E4W6 | 1-168 | None |
| A0A412I5J0 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.