DPCstruct | MC16657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 30.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16138 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0RWY8 | 20-260 | QTIGGIPLPEGYQRITQKTGSFGAWLRQIPLKKDKTVYLYNGTKKFNQLAQYAVLDVSVGDKDLQQCADAVMRLYAEYQYAHALYQQ… |
| A0A662B1J6 | 40-228 | YSYDGSVIMGEYGYQYAVINMDIGKRDLQQCADAVMRLRAEYLYYQKKYTEIHFNFLSDGKARYYTNYSKGNRTYPKFRKYMDYIFA… |
| A0A1F3VAW4 | 105-299 | None |
| A0A0D6JBI4 | 2-201 | None |
| V6HWS0 | 4-165 | None |
| A0A3N1X6B0 | 213-454 | None |
| A0A2K9NTJ7 | 29-218 | None |
| A0A1F3VDN4 | 106-290 | None |
| A0A3L9M9J7 | 267-476 | None |
| A0A7W0EL66 | 25-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.