DPCstruct | MC16654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 223 ± 33 aa |
| Standard deviation of domain lengths | 32.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 19.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3JM37 | 7-213 | AFSLDSGLSADMYNTSRGIESQQLNSNKDLNCPSGFMDAEVLPNSTTASDPNPQPRKSTGPKKTASKVSKGLVKIARIRSMFQQQRR… |
| A0A409YFB6 | 193-398 | SVPINGRKPTPTQAPQTKPQEPPRPPTPKKFEPAIVYGEDHQDAALKIQRQYRIHQSYKALSNFAKQFEEMKRNFAYPHTIDFQKPG… |
| A0A0C3J7B0 | 3-273 | None |
| A0A1E3JMG3 | 267-490 | None |
| A0A0C9Y376 | 1-326 | None |
| A0A5C2SUR7 | 30-290 | None |
| A0A1S8VVT5 | 1-177 | None |
| A0A165ZRE0 | 1-219 | None |
| A0A165ZRH8 | 60-329 | None |
| E3KUS8 | 230-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.