DPCstruct | MC16652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 203 ± 21 aa |
| Standard deviation of domain lengths | 20.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2YZ70 | 95-290 | GNKDVAIVLLGAFSRWINYLEDADIQKPQTQSYLKTLRVGLKLAINEGLAKSQSDLIASFMQTLVMSEGDKWVYSQASTVSRALNAG… |
| A0A2H3JH23 | 3-181 | LKALRVNLRLAIDFGLQTSQSDLIASFLQTLIMSEGDKWVWAQVGNVAAALRAGTDGKPVQTANDAVRGFATKELGKAKLIAAFEDY… |
| A0A4T0Q6Y7 | 697-903 | None |
| A0A836ASN2 | 374-542 | None |
| A0A0K6G5H1 | 1-216 | None |
| A0A194S6I1 | 32-247 | None |
| A0A067M7A7 | 168-406 | None |
| A0A550CT78 | 71-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.