DPCstruct | MC1665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0CVI3 | 1-139 | DLLGLLNWRSNSQNIKHNLKKLMEVDGGEIVKFLQDTLDALFNIMMEMSDNETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYK… |
| A0A7R9G841 | 1-142 | DLLGLLNWVSHPDGLKESLTALMKVDGEEVVKFLQDVLDALFNILMQNSDSDLYDNMVFECLLYIIGLVSDRKYQHFQPVLDLYITE… |
| A0A1S3QES5 | 62-226 | None |
| A0A2R7W8W5 | 57-219 | None |
| A0A6I9XCI7 | 36-198 | None |
| G3I5P7 | 200-338 | None |
| A0A836DAY9 | 132-277 | None |
| A0A212CP23 | 5-168 | None |
| A0A2A2KYJ3 | 546-685 | None |
| A0A0R3S2B9 | 852-988 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.