DPCstruct | MC16648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 469 ± 76 aa |
| Standard deviation of domain lengths | 75.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3KKM3 | 10-427 | YLTSVESYKKLDNNYFHEGNEEECKKLQQKTSNDTEAYLFCMRYTGNLKNYDELEYFDKLKQYKCTYFSLWVNDQLSQFKDEKYSTV… |
| A0A0J9U2B5 | 26-458 | CEYLNYWIHHKTKGNRHRSKIIKLFYYRWDDLNNLKNKNKHCKHKNFNIGEKEFTRKKDLYEFLEFYDSIKGKLEKGESTNNAKYCD… |
| A0A0J9TCU9 | 4-388 | None |
| A5K689 | 13-503 | None |
| A0A1B1E7R0 | 1-406 | None |
| A0A1B1E5Q8 | 391-927 | None |
| A0A1B1E0U0 | 59-387 | None |
| A0A1B1E1P5 | 13-348 | None |
| A0A1B1E0B6 | 4-434 | None |
| A0A1B1DY62 | 482-898 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.