DPCstruct | MC16647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 24.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9SHB4 | 28-197 | YEHLKKGQNDLDSYKKDYKRRHDKKKGLARLDCYYENKIFDKIDYIYDLAKRMRNDKKTYKKYIYRKFTIHFTIFALLPLLGIIIPI… |
| A0A0J9U0Y9 | 23-206 | MREKISDHSVVGKKKIIPNQMSINSQLRGKRLNYIDIYIKDYEKRYRKKKGISKLDCYCEKKVFEKIHNLYEFGKNLQNKKRSKKYV… |
| A0A1Y1JHL7 | 3-224 | None |
| A0A1A7W2T5 | 6-153 | None |
| A0A0J9S4Z7 | 4-163 | None |
| A0A0J9S2J4 | 5-115 | None |
| A0A0J9S2A9 | 5-162 | None |
| A0A0J9W1Q8 | 1-176 | None |
| A0A0J9TJM1 | 37-235 | None |
| A0A0J9TAI5 | 348-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.