DPCstruct | MC16643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 215 ± 30 aa |
| Standard deviation of domain lengths | 29.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 48.11 |
| Assigned Pfam label(s) | PF07196- PF02465- PF07195- PF00669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351CFN0 | 86-271 | LFAANGSTNAGTLEYVLHSRDTEAGEYTVNITTAATQSTSTSNNGTVGENETLTIIDGDKVAEVVLTTDMTFSGIKNAINWEMSKVY… |
| A0A4Q2XMI1 | 37-299 | NAGSGIDTGALVPALVTAQFAAKTAALTAKSTALTSQISGVSSLKSAITTFSSALDSLVKGGTLQTQPTSSDVSSISATAISGAKGS… |
| A0A7Y5VU33 | 1-203 | None |
| A0A4Q2A1W5 | 1-222 | None |
| A0A2U3L222 | 9-211 | None |
| K6UMD5 | 447-602 | None |
| A0A2E8S3X1 | 12-211 | None |
| A0A661L5D0 | 3-200 | None |
| A0A2H0PKZ1 | 24-225 | None |
| A0A365VRC0 | 4-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.