DPCstruct | MC16642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 206 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848I2A9 | 109-287 | TIIMICPTRGFRNANDAAQAGSLGDLLRGREFEDILIAAQDHDLAVADAHAGALPLCRTMERLRHTRLLQRAQLRTWIARGLEVGQV… |
| A0A4Q2X4V1 | 1-198 | MTIVTIDRLAGFVAGHQAPTTTVPIDATRADEIIAEASQGETLRTILAGREIDDILIAVQDDYLRIVDAFASALPLCGNMERTQNSL… |
| A0A2Z6AP27 | 13-230 | None |
| A0A1W7M6K4 | 110-306 | None |
| A0A1T5GLK0 | 210-431 | None |
| S3FFL3 | 352-557 | None |
| A0A7X4K7G4 | 137-350 | None |
| A0A292ZMN1 | 1-206 | None |
| A0A6A7BP63 | 225-437 | None |
| A0A520FA05 | 174-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.