DPCstruct | MC1664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8VWC5 | 101-214 | GMIRMAALCLSLQMVQTAVLPPRWADPTLNPCANQPGGWQLLHWPSDGRCYRIFQQGSPCPDTMELAPSLDGTAECRCPPGTAQSPR… |
| A0A7R9G7H3 | 12-117 | LSLQMVQTAVLPPRWADPTLNPCANQPGGWQLLHWPSDGRCYRIFQQGPPCPDTMELAPSLDGTAECRCPPGTAQSPRDALCHKLYT… |
| A0A6A4W2T1 | 13-127 | None |
| A0A6H5IDB4 | 194-304 | None |
| A0A1I8NB52 | 15-141 | None |
| E9G917 | 121-238 | None |
| A0A182U151 | 7-117 | None |
| A0A6L5CEX9 | 4-107 | None |
| A0A4C1WBK2 | 74-197 | None |
| A0A7R9PE88 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.