DPCstruct | MC16639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 147 ± 30 aa |
| Standard deviation of domain lengths | 29.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5DYX2 | 29-151 | HCLWFLKGTPVTAPLVDDYPQVQAWLGRVLGFGHGAPAEMSAEEALEVARGSQPAALPDESFSDPNGFLPGQAVAIAATDYGVDAVQ… |
| A0A818SVR9 | 26-153 | HGLWFVMEVLGNEVEKILSQLNQPKLLAWFERVAKFGHGTRKEMTPEEALDVAKQTEPVEPTYIQNNSKSEWHVGQQLRVTPDDVGR… |
| Q2HGM0 | 59-184 | None |
| A0A0F9XTC5 | 634-791 | None |
| A0A370TQ04 | 168-328 | None |
| A0A1V8SDH1 | 167-327 | None |
| A0A418WFA3 | 1-78 | None |
| A0A167DAZ1 | 125-306 | None |
| A0A6A6Z6U0 | 540-685 | None |
| F3L1B8 | 153-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.