DPCstruct | MC16638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 231 ± 45 aa |
| Standard deviation of domain lengths | 44.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5RQS5 | 20-227 | WKEHKVDDPIKSGSECLVNNVRSFGGYVYDWPSKYDQIFFPYTSSLAIWFCNDSGFIAFIGDFDNITAAEKTKISEYLQENPPLNIK… |
| A0A818SS93 | 2-213 | VTFSDEVKTCSCCGKSSSQKEIMSYTTFGQPDLDLRPPPMKRDTMFAWIQYCSHCGYCSHDISDQKGVSRKEIIESSDYQAQLSSND… |
| A0A7X9P4Q3 | 9-298 | None |
| A0A2E9JJI7 | 4-215 | None |
| A0A847P4Z4 | 42-319 | None |
| A0A2A4ZJ29 | 1-215 | None |
| A0A3N5QDI8 | 19-242 | None |
| A0A356C141 | 137-359 | None |
| A0A2E6NPK0 | 1-230 | None |
| A0A7Z9HHL3 | 121-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.