DPCstruct | MC16637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 340 |
|---|---|
| Mean domain length (aa) | 251 ± 55 aa |
| Standard deviation of domain lengths | 55.29 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 99.53 |
| Assigned Pfam label(s) | PF01915- PF04122- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644YIG6 | 50-331 | EGNDRYETAIKLSQSKFDKADTVVIVNGNSLADGLTATPLATYKKSPILLTNGHNLSKETKYEIKRLGAKNVIIAGGNISVKDNIET… |
| A0A832ZIC6 | 19-253 | IRATTVIGTTNITFADTIVAKVVSEIYDYPLIILGRDKVSNETLAFLRELNTTEILIIGGPAVISPTVDEELRKLGYSVTRIWGVTR… |
| A0A7L5AP23 | 28-312 | None |
| A0A7L5ADR0 | 46-340 | None |
| A0A259TKX4 | 71-283 | None |
| A0A2W1W5W4 | 386-671 | None |
| A0A7Y0N5S3 | 22-206 | None |
| A0A662U055 | 17-200 | None |
| A0A662QEV0 | 339-628 | None |
| A0A010NNA9 | 25-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.