DPCstruct | MC16635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9LCB8 | 21-135 | PSVEVLLDVDREYRSRAQAGRLPTIAPRRFNPRGESWLPVLHTRRGPWHFTALYSNTAKAHELHREHDWVIVYFYDDDHVEQQHTIV… |
| M5UDX4 | 6-125 | LLDIDREYREKSISGQLPKISPAKLNPENVAWLPILHTERGGRHYTALFSNTARAHELNTTQDWVVIFRDDAQSHGSWTVITSQFGK… |
| D0LVD8 | 266-379 | None |
| A0A849FQS3 | 107-237 | None |
| A0A538SX46 | 177-282 | None |
| A0A1V5HB05 | 138-251 | None |
| A0A3M2DXX3 | 4-113 | None |
| A0A7S8C3H6 | 175-292 | None |
| A0A7Y2N7L4 | 213-311 | None |
| A0A7C6VX75 | 56-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.