DPCstruct | MC16632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 346 ± 45 aa |
| Standard deviation of domain lengths | 45.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1M095 | 330-677 | RETCFDLSILIDPVISQSYLDALGHMSFESILVYVALPRITITDQNSNNRRGRWDMVKVFDWLREKGVKKILSIIVIDSTEPSHSDG… |
| A0A5N6J204 | 309-626 | SGESVPVDKRYIEDLKKESGMQPKNPTRNRYRNGTQEPNVSDPYPDISKWLWDSKVRRIPTVEVDDLGPRPHSNAAIRRCFTGWSCS… |
| A0A428UXU8 | 198-547 | None |
| A0A5J5EHG2 | 14-366 | None |
| A0A7D5UQQ9 | 387-744 | None |
| A0A6A5U9D5 | 494-863 | None |
| A0A0D2YBV4 | 125-511 | None |
| I8A9T3 | 2-235 | None |
| A0A2L2TDJ0 | 2-264 | None |
| A0A428TQM8 | 350-702 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.