DPCstruct | MC1663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 231 |
|---|---|
| Mean domain length (aa) | 129 ± 24 aa |
| Standard deviation of domain lengths | 24.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0269- CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9G4P4 | 18-150 | RVDLIEDAGKSLSPEIDIGQVEGAFIMGLGLWTFEDIIFDPVTGQTLTNRTWNYYVPGAEDIPMDFRVELQKNVSNPLGVLRSKATG… |
| A0A2N2IXV8 | 517-653 | MYGVFMAEVTVDTETGKTAVDRMTLMCDCGKINNRLVVDGQNMGGMAQGIGLALSENFEDIEKHSTMPGAGFPYIKDIPDDMEIIYF… |
| A0A7V9EXK7 | 155-263 | None |
| A0A3S1AYZ8 | 11-108 | None |
| A0A6M7W6K5 | 44-136 | None |
| A0A7C4I2V0 | 25-164 | None |
| A0A2G2KHW2 | 30-183 | None |
| A0A7C2VKE5 | 284-414 | None |
| A0A090MRM4 | 3-109 | None |
| A0A2G1YSN1 | 557-692 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.