DPCstruct | MC16629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 369 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813LM00 | 4-392 | SRLVSSKVASLALALLLIGWSPCHLEVAGQVPDDIADPTNNYNNDNYTQTAVRRLKEKLVCDKAEKEGFACAVCFVDVGKATFFLGQ… |
| A0A813IZ53 | 21-404 | KLAVNAENQMRAVTRKLNEITSKSEADEMVSRAMMAAGKEQKAKWQKRHLATLPAVFQEIQQYKNNKTAADTALNLQRAGRAQCIFN… |
| A0A812UIE5 | 1-339 | None |
| A0A812L7H0 | 46-422 | None |
| A0A813JW29 | 37-403 | None |
| A0A812ZFL4 | 23-480 | None |
| A0A812Q9F9 | 10-348 | None |
| A0A812VE40 | 39-382 | None |
| A0A812LLK0 | 454-823 | None |
| A0A812QC71 | 5-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.