DPCstruct | MC16626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7UQD3 | 204-318 | SFVSQIGWSFEFNAVPIFVTTFAPCYPENHSRYAFGAQNAFILLQPMYSFAIHEIGHDTPTTNWSNPQTIRDKIRVAYKENGRPYYI… |
| A0A813KV43 | 4-122 | IPKKGWYFQFARESIFVTTFAPCYPSSNPRYQFGLQPDSCYILLQPEESFLRHDLPPDKPRSATNWDSPVDVRDRIRVNFRRAGREY… |
| A0A846BMF3 | 78-187 | None |
| A0A812UAB4 | 175-297 | None |
| A0A433JE58 | 137-245 | None |
| A0A819GQV1 | 7-121 | None |
| A0A1Q9CR03 | 577-699 | None |
| A0A7R9W1V5 | 13-131 | None |
| A0A7D5SR37 | 160-273 | None |
| A0A2C9JU22 | 233-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.