DPCstruct | MC1662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0QF37 | 135-207 | VSGRGLGHTGGTVDKIESIQGFRTDLNMEEMRESIKQVGGFINGQTEEIAPADKIIYSLRDVTETTDEISLIT |
| A0A7R9G3Z8 | 1-76 | MISGRGLQFTGGTLDKLESIPGFKVVCTFPALKEALEKAGCFIAGASGSLAPADKHLYKIRDVTGIYNNGWLYASD |
| A0A4U9UG41 | 11-85 | None |
| A0A072NF47 | 109-190 | None |
| A0A365VMK6 | 64-137 | None |
| A0A3Q0IM16 | 108-172 | None |
| A0A1V4QAU2 | 24-104 | None |
| A0A5S9MNJ3 | 1-88 | None |
| A0A1I8HVY2 | 112-186 | None |
| A0A1U7SW05 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.